Structure of PDB 6iqj Chain B

Receptor sequence
>6iqjB (length=131) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
MSWQSYVDDHLMCEVEGNHLTHAAIFGQDGSVWAQSSAFPQLKPAEIAGI
NKDFEEAGHLAPTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQA
LVFGIYDEPMTGGQCNLVVERLGDYLIESGL
3D structure
PDB6iqj Structural and computational examination of theArabidopsisprofilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.
ChainB
Resolution1.922 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B P44 A45 E46 A48 G49 H59 L60 F66 P44 A45 E46 A48 G49 H59 L60 F66
BS02 peptide B M1 W3 Y6 W33 Y125 L131 M1 W3 Y6 W33 Y125 L131
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
Biological Process
GO:0006952 defense response
GO:0008154 actin polymerization or depolymerization
GO:0010229 inflorescence development
GO:0048366 leaf development
GO:0048527 lateral root development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6iqj, PDBe:6iqj, PDBj:6iqj
PDBsum6iqj
PubMed31653702
UniProtQ42418|PRF2_ARATH Profilin-2 (Gene Name=PRF2)

[Back to BioLiP]