Structure of PDB 6ip2 Chain B

Receptor sequence

>6ip2B (length=520) Species: 10029 (Cricetulus griseus)

EKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCG
KTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRR
LGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLN
NILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMR
GHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEV
DMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVT
RVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFI
KICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIG
PRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTI
HVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIE
MSLQMDPEYRVRKFLALLRE

3D structure

• PDB: 6ip2 Mechanistic insights into the SNARE complex disassembly.
• Chain: B
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.6: vesicle-fusing ATPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	I220 G221 G263 C264 G265 K266 T267 L268 I406 E442	I5 G6 G48 C49 G50 K51 T52 L53 I191 E227
BS02	ATP	B	M504 N505 G506 I507 I508 V514 P545 H546 G548 K549 T550 A551 L552 I707 K708 L711	M289 N290 G291 I292 I293 V299 P330 H331 G333 K334 T335 A336 L337 I492 K493 L496
BS03	ATP	B	R385 R388	R170 R173

Gene Ontology

Molecular Function

• GO:0000149 SNARE binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0017075 syntaxin-1 binding
• GO:0019901 protein kinase binding
• GO:0019905 syntaxin binding
• GO:0030165 PDZ domain binding
• GO:0035255 ionotropic glutamate receptor binding
• GO:0042802 identical protein binding
• GO:0044877 protein-containing complex binding
• GO:0046872 metal ion binding
• GO:0140545 ATP-dependent protein disaggregase activity

Biological Process

• GO:0001921 positive regulation of receptor recycling
• GO:0006813 potassium ion transport
• GO:0006886 intracellular protein transport
• GO:0006891 intra-Golgi vesicle-mediated transport
• GO:0015031 protein transport
• GO:0035494 SNARE complex disassembly
• GO:0043001 Golgi to plasma membrane protein transport
• GO:0045732 positive regulation of protein catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus
• GO:0005795 Golgi stack
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0030496 midbody

External links

• PDB: RCSB:6ip2, PDBe:6ip2, PDBj:6ip2
• PDBsum: 6ip2
• PubMed: 30989110
• UniProt: P18708|NSF_CRIGR Vesicle-fusing ATPase (Gene Name=NSF)