Structure of PDB 6imn Chain B

Receptor sequence

>6imnB (length=408) Species: 10497 (African swine fever virus)

LNQFPGQYSNNIFCFPPIESETKSGKKASWIICVQVVQHNTIIPITDEMF
STDVKDAVAEIFTKFFVEEGAVRISKMTRVTEGKNLGKKNATTVVHQAFK
DALSKYNRHARQKRGGMIPPMLVKYFNIIPKTFFEEETDPIVQRKRNGVR
AVACQQGDGCILLYSRTEKEFLGLDNIKKELKQLYLFIDVRVYLDGELYL
HRKPLQWIAGQANAKTDSSELHFYVFDCFWSDQLQMPSNKRQQLLTNIFK
QKEDLTFIHQVENFSVKNVDEALRLKAQFIKEGYEGAIVRNANGPYEPGY
NNYHSAHLAKLKPLLDAEFILVDYTQGKKGKDLGAILWVCELPNKKRFVV
TPKHLTYADRYALFQKLTPALFKKHLYGKELTVEYAELSPKTGIPLQARA
VGFREPIN

3D structure

• PDB: 6imn Structure of the error-prone DNA ligase of African swine fever virus identifies critical active site residues.
• Chain: B
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 6.5.1.1: DNA ligase (ATP).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K24 W31 K90 N91 K114 Q212 G216 A220 N307 Y309 K335 K337 F354 V355 S395 K397 T398	K23 W30 K89 N90 K113 Q206 G210 A214 N301 Y303 K329 K331 F348 V349 S389 K391 T392
BS02	dna	B	S25 G71 A72 R74 K85 N86 Q98 S105 R109 R112 S171 R172 T173 K175 L211 N219 K359 T362 Y363 Q403 R405	S24 G70 A71 R73 K84 N85 Q97 S104 R108 R111 S165 R166 T167 K169 L205 N213 K353 T356 Y357 Q397 R399

Gene Ontology

Molecular Function

• GO:0003909 DNA ligase activity
• GO:0003910 DNA ligase (ATP) activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006281 DNA repair
• GO:0006310 DNA recombination
• GO:0051301 cell division

Cellular Component

• GO:0044423 virion component

External links

• PDB: RCSB:6imn, PDBe:6imn, PDBj:6imn
• PDBsum: 6imn
• PubMed: 30674878
• UniProt: P35970|DNLI_ASFB7 DNA ligase (Gene Name=LIG)