Structure of PDB 6iir Chain B |
>6iirB (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFG THETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY |
|
PDB | 6iir Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
B |
R78 K79 |
R78 K79 |
PDBbind-CN: Kd=2.8uM |
|
|