Structure of PDB 6ii1 Chain B

Receptor sequence

>6ii1B (length=143) Species: 9913 (Bos taurus)

LTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTAD
AVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPEN
FKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRY

3D structure

• PDB: 6ii1 Quaternary Structure Analysis of a Hemoglobin Core in Hemoglobin-Albumin Cluster.
• Chain: B
• Resolution: 1.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	T38 F41 F42 H63 K66 S70 F71 L88 H92 L96 N102 L106 L141	T36 F39 F40 H61 K64 S68 F69 L86 H90 L94 N100 L104 L139

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:6ii1, PDBe:6ii1, PDBj:6ii1
• PDBsum: 6ii1
• PubMed: 30444368
• UniProt: P02070|HBB_BOVIN Hemoglobin subunit beta (Gene Name=HBB)