Structure of PDB 6i1p Chain B

Receptor sequence

>6i1pB (length=437) Species: 300852 (Thermus thermophilus HB8)

TGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPD
EVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSF
KDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKE
ARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRL
KPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKL
YQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLP
FTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHE
SCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCP
LADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR

3D structure

• PDB: 6i1p Key role of quinone in the mechanism of respiratory complex I.
• Chain: B
• Resolution: 3.207 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	P199 S352 C353 G354 K355 C356 C359 C400 L402	P198 S351 C352 G353 K354 C355 C358 C399 L401
BS02	FMN	B	G64 G66 N92 D94 G183 E184 N219 N220 T223	G63 G65 N91 D93 G182 E183 N218 N219 T222
BS03	NAI	B	G66 G67 F70 K75 E97 Y180 E185	G65 G66 F69 K74 E96 Y179 E184

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:6i1p, PDBe:6i1p, PDBj:6i1p
• PDBsum: 6i1p
• PubMed: 32811817
• UniProt: Q56222|NQO1_THET8 NADH-quinone oxidoreductase subunit 1 (Gene Name=nqo1)