Structure of PDB 6hl3 Chain B

Receptor sequence

>6hl3B (length=416) Species: 63363 (Aquifex aeolicus)

SYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSPE
EIIDWVDKSTLRGRGGAGFPTGKKWKFAVQNPGPRYFICNADESEPGTFK
DRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEEA
KKKGFLGKNILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRLK
PPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRYIGPSDYAGPKLF
PVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFSS
EELDIPMDYSPLGFGGTGTVIVLTEEDDIVEAALKIAEFYEHETCGQCTP
CRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAGRL
IRQTLEKFPEEWEKYR

3D structure

• PDB: 6hl3 A mechanism to prevent production of reactive oxygen species by Escherichia coli respiratory complex I.
• Chain: B
• Resolution: 2.04 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	I181 P199 T346 C347 G348 Q349 C350 C353 S391 I392 C393 L395 G396	I179 P197 T344 C345 G346 Q347 C348 C351 S389 I390 C391 L393 G394
BS02	FMN	B	G65 G67 K76 N92 D94 E95 G183 E184 E185 V218 N219 N220 T223	G63 G65 K74 N90 D92 E93 G181 E182 E183 V216 N217 N218 T221
BS03	NAD	B	G67 G68 A69 F71 K76 E97 Y180 E185 K202 Y205	G65 G66 A67 F69 K74 E95 Y178 E183 K200 Y203

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

External links

• PDB: RCSB:6hl3, PDBe:6hl3, PDBj:6hl3
• PDBsum: 6hl3
• PubMed: 31186428
• UniProt: O66841|NUOF_AQUAE NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)