Structure of PDB 6hij Chain B

Receptor sequence

>6hijB (length=572) Species: 9606 (Homo sapiens) [Search protein sequence]

GAVLSFHNICYRVKLPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDV
LAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQF
SAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERK
RTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSI
HQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPAD
FFLDIINGDLIEKLAEIYVNSSFYKETKAELHQLSGYTTSFCHQLRWVSK
RSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDSTGIQNRAGVLFF
LTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLPMR
MLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQS
VVSVATLLMTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQ
HNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNHVA
LACMIVIFLTIAYLKLLFLKKY

3D structure

PDB

6hij Structural basis of small-molecule inhibition of human multidrug transporter ABCG2.

Chain

Resolution

3.56 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

7.6.2.2: ABC-type xenobiotic transporter.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BWQ	B	L539 I543 V546 M549	L457 I461 V464 M467
BS02	CLR	B	F571 Y576 I639	F489 Y494 I557
BS03	CLR	B	F547 F640 K647	F465 F558 K565
BS04	CLR	B	S467 L471 Y645	S385 L389 Y563
BS05	CLR	B	M514 W627	M432 W545
BS06	CLR	B	S381 P480 L484	S299 P398 L402
BS07	BWQ	B	A397 V401 L405 F432 T435 N436 F439 S440	A315 V319 L323 F350 T353 N354 F357 S358

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008514	organic anion transmembrane transporter activity
GO:0008559	ABC-type xenobiotic transporter activity
GO:0015143	urate transmembrane transporter activity
GO:0015225	biotin transmembrane transporter activity
GO:0015562	efflux transmembrane transporter activity
GO:0016887	ATP hydrolysis activity
GO:0032217	riboflavin transmembrane transporter activity
GO:0042626	ATPase-coupled transmembrane transporter activity
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0042910	xenobiotic transmembrane transporter activity
GO:0046624	sphingolipid transporter activity
GO:0046983	protein dimerization activity
GO:0140359	ABC-type transporter activity

	Biological Process
GO:0006869	lipid transport
GO:0015711	organic anion transport
GO:0015747	urate transport
GO:0015878	biotin transport
GO:0030148	sphingolipid biosynthetic process
GO:0032218	riboflavin transport
GO:0046415	urate metabolic process
GO:0055085	transmembrane transport
GO:0070633	transepithelial transport
GO:0097744	renal urate salt excretion
GO:0140115	export across plasma membrane
GO:0150104	transport across blood-brain barrier
GO:1990748	cellular detoxification
GO:1990962	xenobiotic transport across blood-brain barrier

	Cellular Component
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0016324	apical plasma membrane
GO:0031526	brush border membrane
GO:0031966	mitochondrial membrane
GO:0045121	membrane raft
GO:0098591	external side of apical plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hij, PDBe:6hij, PDBj:6hij
PDBsum	6hij
PubMed	29610494
UniProt	Q9UNQ0\|ABCG2_HUMAN Broad substrate specificity ATP-binding cassette transporter ABCG2 (Gene Name=ABCG2)

[Back to BioLiP]