Structure of PDB 6haj Chain B |
>6hajB (length=55) Species: 500485 (Penicillium rubens Wisconsin 54-1255) [Search protein sequence] |
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNN AVDCD |
|
PDB | 6haj Calixarene-mediated assembly of a small antifungal protein. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
EVB |
B |
K27 P29 K30 |
K27 P29 K30 |
MOAD: Kd=10.6uM PDBbind-CN: -logKd/Ki=4.97,Kd=10.6uM |
|
|
|