Structure of PDB 6h9h Chain B

Receptor sequence

>6h9hB (length=250) Species: 76114 (Aromatoleum aromaticum EbN1) [Search protein sequence]

GQQHLLRFALPAGKKLWPNDLREALAKHDLPPLFFSRDPQTGHAITRAMR
NEKRVRGYIEQHGHEPPPPTEEQRANPLAIPGIRIVGSSTWVGILATGER
YKPLLEAATLPAIQIVTQRCGRGVGVELEQHTLSIKGLDDPKRYFVRNLV
MKRGLTKTAENTTQVASRILSALERQAVAYSLDLPPTAQVDIHVESVVRP
RGMRLVTSTGATEQFVGLADVEFYACLDLKGYWFAGNLTSRGYGRIIADH

3D structure

PDB

6h9h Type IV CRISPR RNA processing and effector complex formation in Aromatoleum aromaticum.

Chain

Resolution

1.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R8 W18 H44 A45 I46 T47 R48 K54 R55 S89 S90 W92 F146 R148 N149 K153 R154 L156 K158 R169 R176 R200 P201 R202 G203 M204 L206 T208 T213 E214 Q215 F216 N238 L239 S241 R242 Y244 R246 I248 H251	R7 W17 H43 A44 I45 T46 R47 K53 R54 S88 S89 W91 F145 R147 N148 K152 R153 L155 K157 R168 R175 R199 P200 R201 G202 M203 L205 T207 T212 E213 Q214 F215 N237 L238 S240 R241 Y243 R245 I247 H250
BS02	MN	B	D192 H194	D191 H193

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6h9h, PDBe:6h9h, PDBj:6h9h
PDBsum	6h9h
PubMed	30397343
UniProt	Q5NWP0

[Back to BioLiP]