Structure of PDB 6h6o Chain B |
>6h6oB (length=116) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
FKPLVTAGIESLLNTFLYRSPALKTARSRLLGKVLRVEVKGFSTSLILVF SERQVDVLGEWAGDADCTVIAYASVLPKLRDRQQLTALIRSGELEVQGDI QVVQNFVALADLAEFD |
|
PDB | 6h6o A Soluble Metabolon Synthesizes the Isoprenoid Lipid Ubiquinone. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D124 E127 D129 |
D111 E114 D116 |
|
|
|
|