Structure of PDB 6h1c Chain B

Receptor sequence
>6h1cB (length=134) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
MVENSELRKAGLKVTLPRVKILQMLDSAEQRHMSAEDVYKALMEAGEDVG
LATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGAHDHMVCVDTGEVIE
FMDAEIEKRQKEIVRERGFELVDANLVLYVRKKK
3D structure
PDB6h1c Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
ChainB
Resolution2.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN B A35 E36 A35 E36
BS02 MN B E105 R109 E105 R109
BS03 ZN B H32 E80 H89 E100 H32 E80 H89 E100
BS04 ZN B D88 E107 D88 E107
BS05 ZN B H87 D123 H87 D123
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0019290 siderophore biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h1c, PDBe:6h1c, PDBj:6h1c
PDBsum6h1c
PubMed
UniProtQ03456|FUR_PSEAE Ferric uptake regulation protein (Gene Name=fur)

[Back to BioLiP]