Structure of PDB 6gxv Chain B

Receptor sequence

>6gxvB (length=481) Species: 61169 (Alicyclobacillus sp.)

GDNGTMMQYFEWYLPNDGTLWTKMGSDASHLKSIGITGVWFPPAYKGQSQ
SDVGYGVYDMYDLGEFNQKGTVRTKYGTKAQLQSAITSLHNNGIQAYGDV
VLNHRMGADATETISAVEVNPSNRNQVTSGAYNISAWTDFEFPGRGNTYS
SFKWHSYYFDGVDWDQSRQLSGKIYQIQGKAWDWEVDSENGNYDYLMGAD
IDYDHPDVQTEVKNWGKWFVNTLNLDGVRLDAVKHIKFDYMSSWLSSVKS
TTGKSNLFAVGEYWNTSLGALENYENKTNWSMSLFDVPLHMNFQAAANGG
GYYDMRNLLNNTMMKNHPIQAVTFVDNHDTEPGQALQSWVSDWFKPLAYA
TILTRQEGYPCVFYGDYYGIPSQSVSAKSTWLDKQLSARKSYAYGTQHDY
LDNQDVIGWTREGDSAHAGSGLATVMSDGPGGSKTMYVGTAHAGQVFKDI
TGNRTDTVTINSAGNGTFPCNGGSVSIWVKQ

3D structure

• PDB: 6gxv The structure of the AliC GH13 alpha-amylase from Alicyclobacillus sp. reveals the accommodation of starch branching points in the alpha-amylase family.
• Chain: B
• Resolution: 2.07 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	B	G7 I322 Y362	G4 I319 Y359
BS02	GLC	B	T40 Q98 Y362	T37 Q95 Y359
BS03	GLC	B	E192 Y196 K237 L339	E189 Y193 K234 L336
BS04	AC1	B	Y58 H107 D234 A235 H238 E265 H331 D332	Y55 H104 D231 A232 H235 E262 H328 D329
BS05	GLC	B	W15 M200	W12 M197
BS06	AC1	B	D166 M200 G201	D163 M197 G198
BS07	GLC	B	L339 Q340 S341	L336 Q337 S338
BS08	BGC	B	W267 L339 Q340 S341	W264 L336 Q337 S338
BS09	GLC	B	Q297 N301 Q340 W342	Q294 N298 Q337 W339
BS10	BGC	B	Q297 N301 Q340 S341 W342	Q294 N298 Q337 S338 W339
BS11	CA	B	N106 D197 D203 H238	N103 D194 D200 H235
BS12	CA	B	D163 A184 D186 D205 D207	D160 A181 D183 D202 D204
BS13	CA	B	G304 Y306 Q407 D408 D431	G301 Y303 Q404 D405 D428
BS14	GLC	B	N128 W187 N195	N125 W184 N192

Gene Ontology

Molecular Function

• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0005509 calcium ion binding

Biological Process

• GO:0005975 carbohydrate metabolic process

External links

• PDB: RCSB:6gxv, PDBe:6gxv, PDBj:6gxv
• PDBsum: 6gxv
• PubMed: 30644839
• UniProt: A0A3P8MUS3