Structure of PDB 6gok Chain B |
>6gokB (length=124) Species: 9913 (Bos taurus) [Search protein sequence] |
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT QANKHIIVACEGNPYVPVHFDASV |
|
PDB | 6gok Exploring the interactions between model proteins and Pd(ii) or Pt(ii) compounds bearing charged N,N-pyridylbenzimidazole bidentate ligands by X-ray crystallography. |
Chain | B |
Resolution | 2.65 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
F6Q |
B |
A4 K7 V118 H119 |
A4 K7 V118 H119 |
|
|
|
|