Structure of PDB 6gnq Chain B

Receptor sequence

>6gnqB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 6gnq Monoclinic crystalline form of human insulin, complexed with meta-cresol
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q4 C7 L11 L15 V18 C19 R22 F24 F25 Y26	Q4 C7 L11 L15 V18 C19 R22 F24 F25 Y26
BS02	peptide	B	H5 G8 S9 V12 E13 Y16 E21 G23 F24 F25 Y26 P28	H5 G8 S9 V12 E13 Y16 E21 G23 F24 F25 Y26 P28
BS03	peptide	B	F1 V2	F1 V2
BS04	peptide	B	L6 S9 H10	L6 S9 H10
BS05	IS8	B	L6 H10	L6 H10

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:6gnq, PDBe:6gnq, PDBj:6gnq
• PDBsum: 6gnq
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)