Structure of PDB 6gmx Chain B |
>6gmxB (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
MYVKLISSDGHEFIVKREHALTSGTIKAMLSTNEVNFREIPSHVLSKVCM YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
|
PDB | 6gmx Surface Probing by Fragment-Based Screening and Computational Methods Identifies Ligandable Pockets on the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase. |
Chain | B |
Resolution | 2.533 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
F7B |
B |
E64 E102 F109 |
E39 E77 F84 |
PDBbind-CN: -logKd/Ki=2.17,Kd=6.7mM BindingDB: Kd=6.7nM |
|
|
|