Structure of PDB 6gf7 Chain B |
>6gf7B (length=103) Species: 9031 (Gallus gallus) [Search protein sequence] |
LLQYHYDCGDFGMQLLAYPTRGRTVHFKVLDEFGTRFEVANCSICMHWLN TGEDGGLIFSAGYEGCHVLVKDGRYVLRVQLEEMLLSGVVAASYEVQMTC PRP |
|
PDB | 6gf7 Molecular basis of egg coat cross-linking sheds light on ZP1-associated female infertility. |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H29 D31 |
H5 D7 |
|
BS02 |
ZN |
B |
H50 E106 |
H26 E82 |
|
|
|