Structure of PDB 6ges Chain B

Receptor sequence
>6gesB (length=350) Species: 9606 (Homo sapiens) [Search protein sequence]
PGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKIS
PFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDL
METDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTK
SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIIN
MKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEA
LAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPG
3D structure
PDB6ges Leveraging Compound Promiscuity to Identify Targetable Cysteines within the Kinome.
ChainB
Resolution2.07 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D166 K168 N171 D184 T207
Catalytic site (residue number reindexed from 1) D142 K144 N147 D160 T183
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 6H3 B I48 G49 V56 A69 Q122 D123 M125 E126 K131 L173 C183 I24 G25 V32 A45 Q98 D99 M101 E102 K107 L149 C159
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0019902 phosphatase binding
GO:0042802 identical protein binding
GO:0106310 protein serine kinase activity
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0000165 MAPK cascade
GO:0006351 DNA-templated transcription
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0008286 insulin receptor signaling pathway
GO:0009887 animal organ morphogenesis
GO:0010759 positive regulation of macrophage chemotaxis
GO:0014032 neural crest cell development
GO:0014044 Schwann cell development
GO:0016310 phosphorylation
GO:0019233 sensory perception of pain
GO:0030278 regulation of ossification
GO:0030509 BMP signaling pathway
GO:0030641 regulation of cellular pH
GO:0030878 thyroid gland development
GO:0031281 positive regulation of cyclase activity
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0032206 positive regulation of telomere maintenance
GO:0032496 response to lipopolysaccharide
GO:0032872 regulation of stress-activated MAPK cascade
GO:0033554 cellular response to stress
GO:0034198 cellular response to amino acid starvation
GO:0035556 intracellular signal transduction
GO:0038083 peptidyl-tyrosine autophosphorylation
GO:0038133 ERBB2-ERBB3 signaling pathway
GO:0042473 outer ear morphogenesis
GO:0042552 myelination
GO:0042770 signal transduction in response to DNA damage
GO:0043330 response to exogenous dsRNA
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048009 insulin-like growth factor receptor signaling pathway
GO:0048538 thymus development
GO:0050804 modulation of chemical synaptic transmission
GO:0051090 regulation of DNA-binding transcription factor activity
GO:0051216 cartilage development
GO:0051403 stress-activated MAPK cascade
GO:0051493 regulation of cytoskeleton organization
GO:0060020 Bergmann glial cell differentiation
GO:0060324 face development
GO:0060425 lung morphogenesis
GO:0060440 trachea formation
GO:0061308 cardiac neural crest cell development involved in heart development
GO:0070371 ERK1 and ERK2 cascade
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070498 interleukin-1-mediated signaling pathway
GO:0070849 response to epidermal growth factor
GO:0071260 cellular response to mechanical stimulus
GO:0071356 cellular response to tumor necrosis factor
GO:0072584 caveolin-mediated endocytosis
GO:0090170 regulation of Golgi inheritance
GO:0098792 xenophagy
GO:0120041 positive regulation of macrophage proliferation
GO:1904262 negative regulation of TORC1 signaling
GO:1904417 positive regulation of xenophagy
GO:2000641 regulation of early endosome to late endosome transport
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005788 endoplasmic reticulum lumen
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005901 caveola
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0031143 pseudopodium
GO:0070161 anchoring junction
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ges, PDBe:6ges, PDBj:6ges
PDBsum6ges
PubMed30982749
UniProtP27361|MK03_HUMAN Mitogen-activated protein kinase 3 (Gene Name=MAPK3)

[Back to BioLiP]