Structure of PDB 6gd8 Chain B

Receptor sequence

>6gd8B (length=108) Species: 559292 (Saccharomyces cerevisiae S288C)

AEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEG
YSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLI
TYLKKATE

3D structure

• PDB: 6gd8 Auto-regulated Protein Assembly on a Supramolecular Scaffold.
• Chain: B
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EVB	B	T69 N70 K72 K73 G83 G84 K86	T74 N75 K77 K78 G88 G89 K91
BS02	HEC	B	R13 C14 C17 H18 G29 P30 L32 I35 Y48 T49 W59 M64 L68 T78 M80 L94	R18 C19 C22 H23 G34 P35 L37 I40 Y53 T54 W64 M69 L73 T83 M85 L99
BS03	EVB	B	K4 K5 T8 K11 T12 R13	K9 K10 T13 K16 T17 R18

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:6gd8, PDBe:6gd8, PDBj:6gd8
• PDBsum: 6gd8
• PubMed: 30109907
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)