Structure of PDB 6g99 Chain B

Receptor sequence
>6g99B (length=41) Species: 9606 (Homo sapiens) [Search protein sequence]
GPLGSGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDG
3D structure
PDB6g99 The Solution Structure of FUS Bound to RNA Reveals a Bipartite Mode of RNA Recognition with Both Sequence and Shape Specificity.
ChainB
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B S418 G419 Q420 Q421 R422 D425 N435 M436 N437 F438 S439 W440 R441 N445 S5 G6 Q7 Q8 R9 D12 N22 M23 N24 F25 S26 W27 R28 N32 PDBbind-CN: Kd=29.5uM
BS02 ZN B C428 C433 C444 C447 C15 C20 C31 C34
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6g99, PDBe:6g99, PDBj:6g99
PDBsum6g99
PubMed30581145
UniProtP35637|FUS_HUMAN RNA-binding protein FUS (Gene Name=FUS)

[Back to BioLiP]