Structure of PDB 6g1i Chain B

Receptor sequence

>6g1iB (length=210) Species: 203119 (Acetivibrio thermocellus ATCC 27405) [Search protein sequence]

DGYFPPGTSKHELIARASSLKVSEVKAIIKKQVDEHWDVIRDVCGFKNKE
VAYAFFFGMATRESTFRAATETGSGASHAFGPLQTAETAYANANPNYMPE
HNVPEMHQYDFTEYNFYDVGISVHMGIRHFLHFARLAKEKYSGRDIARHG
LMGYNTGWIDGADESWIVRYADETAALGAWYLRNNHMSDDEFTWDTDPRV
DRSNPWEIYY

3D structure

PDB

6g1i Structural studies of the unusual metal-ion site of the GH124 endoglucanase from Ruminiclostridium thermocellum.

Chain

Resolution

0.99 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BGC	B	H151 A155	H11 A15
BS02	FRU	B	E203 T212 S217 Q224 Y294 N295	E63 T72 S77 Q84 Y154 N155
BS03	BGC	B	A216 S217 A226 T228 H269 Y294 N295 T296	A76 S77 A86 T88 H129 Y154 N155 T156
BS04	BGC	B	A216 Y237 M238 T296 W298	A76 Y97 M98 T156 W158
BS05	BGC	B	N236 M238	N96 M98
BS06	BGC	B	F332 W334	F192 W194
BS07	BGC	B	T205 R207 D335	T65 R67 D195
BS08	BGC	B	R202 E203 S204 T205 D335	R62 E63 S64 T65 D195
BS09	BGC	B	E203 W306	E63 W166
BS10	MN	B	D141 Q172 E175 H176 X264	D1 Q32 E35 H36 X124

External links

PDB	RCSB:6g1i, PDBe:6g1i, PDBj:6g1i
PDBsum	6g1i
PubMed	30084399
UniProt	A3DCJ4

[Back to BioLiP]