Structure of PDB 6fz6 Chain B

Receptor sequence

>6fz6B (length=341) Species: 479434 (Sphaerobacter thermophilus DSM 20745)

PMALYDLTLAELEERLAADGVPRYRARQIFHWAYRQLAVDYDAMTVLPKT
LRADLATRLPLTPLTPVREVQTDDGETIKTLFRTVDGQHIETVLMFYPDR
TTVCVSCQVGCAVGCSFCATGMMGLTRNLTAGEMVAQVVAAARRAREAGR
TLTNIVMMGMGEPFQNYEATMRMVRILHEEEGMNFGARRITVSTSGLVPF
IDRLAREPFQVKLAVSLHAPNDDLRSSLVPLNRRYPIGELIAACRRYVGE
TGRRVTFEYVLIDGVNDSDANAEELARLLRGLLCHVNLIPLNPTPAAPFG
RPSVERINRFEQILRARGIPATVRYSRGVDISAACGQLRAE

3D structure

• PDB: 6fz6 Crystal Structure of a radical SAM methyltransferase from Sphaerobacter thermophilus
• Chain: B
• Resolution: 1.42 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.192: 23S rRNA (adenine(2503)-C(2))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C110 V112 C114 C117 G120 G160 S194	C111 V113 C115 C118 G121 G161 S195
BS02	SAH	B	F116 C117 M157 G160 E161 S192 S215 H217 V259 N291 C334 G335	F117 C118 M158 G161 E162 S193 S216 H218 V260 N292 C335 G336

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0002935 tRNA (adenine(37)-C2)-methyltransferase activity
• GO:0003824 catalytic activity
• GO:0008168 methyltransferase activity
• GO:0008173 RNA methyltransferase activity
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:0070040 rRNA (adenine(2503)-C2-)-methyltransferase activity

Biological Process

• GO:0006364 rRNA processing
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation
• GO:0070475 rRNA base methylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6fz6, PDBe:6fz6, PDBj:6fz6
• PDBsum: 6fz6
• UniProt: D1C4T7