Structure of PDB 6fu3 Chain B

Receptor sequence

>6fu3B (length=324) Species: 485 (Neisseria gonorrhoeae)

GEDQDLLKRAQGVFQPLPTVEEMQKIRPFTEEQVKLGHQLWYEPRLSKGN
TVSCNSCHNLASAGVDNMPTSQGHKGQFGGRNSPTALNAALLGSQFWDGR
AADVEEQAGGPLVNPVEMANDSQEAAAAKIAKVPEYQEMFKKAFPEDGAV
SFKNITTALGAFERTLLTPTKWDEYLKGNVNALSEQERKGVRAFMDNGCI
ACHNGVNLGGTTFQKFGLVQGPYWKFIEDPKRDKGRADVTKKTEDEFFFR
VPGLRNVAKTYPYFHNGSVWELDKAVTIMGKAQLGKDIPKEDVDNIVVFL
NALSGNVSESARTMPELPLTAPME

3D structure

• PDB: 6fu3 Structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium Neisseria gonorrhoeae
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	N83 T261 P263	N82 T260 P262
BS02	HEC	B	C55 C58 H59 Q73 G74 R82 N83 S84 P85 Q96 F97 W98 R101 Q108 P112 E118 M119 E164 R251	C54 C57 H58 Q72 G73 R81 N82 S83 P84 Q95 F96 W97 R100 Q107 P111 E117 M118 E163 R250
BS03	HEC	B	W98 C200 C203 H204 Q215 F217 F250 P253 L255 F265 H266 M280 Q284 L285	W97 C199 C202 H203 Q214 F216 F249 P252 L254 F264 H265 M279 Q283 L284

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:6fu3, PDBe:6fu3, PDBj:6fu3
• PDBsum: 6fu3
• UniProt: Q5F5Z9