Structure of PDB 6fkz Chain B

Receptor sequence

>6fkzB (length=266) Species: 7955 (Danio rerio)

SSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLA
TPEAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQQGRSVV
IITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDG
KGAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVE
RELEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNMECTPATQRFK
YHFEGPCGSTLPPALE

3D structure

• PDB: 6fkz Potent and Selective Inhibitors of Human Sirtuin 5.
• Chain: B
• Resolution: 3.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P64 T65 F66 R67 N137 D139 H154
• Catalytic site (residue number reindexed from 1): P32 T33 F34 R35 N105 D107 H122
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C162 C165 C203 C208	C130 C133 C171 C176

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0008270 zinc ion binding
• GO:0016740 transferase activity
• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0034979 NAD-dependent protein lysine deacetylase activity
• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0046872 metal ion binding
• GO:0061697 protein-glutaryllysine deglutarylase activity
• GO:0070403 NAD+ binding
• GO:1901363 heterocyclic compound binding

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006476 protein deacetylation
• GO:0010566 regulation of ketone biosynthetic process
• GO:0036047 peptidyl-lysine demalonylation
• GO:0036048 protein desuccinylation
• GO:0036049 peptidyl-lysine desuccinylation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:6fkz, PDBe:6fkz, PDBj:6fkz
• PDBsum: 6fkz
• PubMed: 29494161
• UniProt: Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=sirt5)