Structure of PDB 6fko Chain B

Receptor sequence

>6fkoB (length=343) Species: 1076759 (Vibrio phage phiVC8)

MENVDLVIDLQFGSTGKGLIAGYLAEKNGYDTVINANMPNAGHTYINAEG
RKWMHKVLPNGIVSPNLKRVMLGAGSVFSINRLMEEIEMSKDLLHDKVAI
LIHPMATVLDEEAHKKAEVGIATSIGSTGQGSMAAMVEKLQRDPTNNTIV
ARDVAQYDGRIAQYVCTVEEWDMALMASERILAEGAQGFSLSLNQEFYPY
CTSRDCTPARFLADMGIPLPMLNKVIGTARCHPIRVGGTSGGHYPDQEEL
TWEQLGQVPELTTVTKKVRRVFSFSFIQMQKAMWTCQPDEVFLNFCNYLS
PMGWQDIVHQIEVAAQSRYCDAEVKYLGFGPTFNDVELREDVM

3D structure

• PDB: 6fko Deoxyguanylosuccinate synthase (DgsS) quaternary structure with ATP, dGMP, HAdacidin at 2.1 Angstrom resolution
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S14 K17 G42 H43 Q187
• Catalytic site (residue number reindexed from 1): S14 K17 G42 H43 Q187
• Enzyme Commision number: 6.3.4.25: 2-amino-2'-deoxyadenylo-succinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DGP	B	N40 A41 S127 T128 Q187 L191 C201 T202 V236	N40 A41 S127 T128 Q187 L191 C201 T202 V236
BS02	ATP	B	G13 S14 G16 K17 A41 G42 H43 T44 N294 F295 N297 G330 P331	G13 S14 G16 K17 A41 G42 H43 T44 N294 F295 N297 G330 P331

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004019 adenylosuccinate synthase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0044208 'de novo' AMP biosynthetic process
• GO:0046040 IMP metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6fko, PDBe:6fko, PDBj:6fko
• PDBsum: 6fko
• UniProt: G3FFN6|PURZ_BPVC8 N6-succino-2-amino-2'-deoxyadenylate synthase (Gene Name=purZ)