Structure of PDB 6fkj Chain B

Receptor sequence

>6fkjB (length=424) Species: 9913 (Bos taurus)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVY
YNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL
LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL
RKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACD
PRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVC
DIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMD
EMEFTEAESNMNDLVSEYQQYQDA

3D structure

• PDB: 6fkj High-affinity ligands of the colchicine domain in tubulin based on a structure-guided design.
• Chain: B
• Resolution: 2.148 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DLW	B	N167 F169 E200 Y202 V238 L242 L248 L252 L255 M259 A316 I318 K352 A354	N165 F167 E198 Y200 V236 L240 L246 L250 L253 M257 A310 I312 K346 A348
BS02	GDP	B	G10 Q11 C12 S140 G143 G144 T145 G146 D179 E183 N206 Y224 N228	G10 Q11 C12 S138 G141 G142 T143 G144 D177 E181 N204 Y222 N226

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0007399 nervous system development
• GO:1902669 positive regulation of axon guidance

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:6fkj, PDBe:6fkj, PDBj:6fkj
• PDBsum: 6fkj
• PubMed: 29523799
• UniProt: Q6B856|TBB2B_BOVIN Tubulin beta-2B chain (Gene Name=TUBB2B)