Structure of PDB 6fie Chain B

Receptor sequence
>6fieB (length=255) Species: 9606 (Homo sapiens) [Search protein sequence]
GPHMAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQAR
KKAGLELSPEMKTFVDQYKIGIVELAHVLPTEENFLLLFRCQQLKSCEEF
MKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKL
FDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGN
GYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLA
LILCA
3D structure
PDB6fie The X-ray structure of human calbindin-D28K: an improved model.
ChainB
Resolution1.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B D199 D201 N203 Y205 E210 D196 D198 N200 Y202 E207
BS02 CA B D111 D113 S115 F117 E119 E122 D108 D110 S112 F114 E116 E119
BS03 CA B D155 N157 D159 K161 E166 D152 N154 D156 K158 E163
BS04 CA B D24 D26 S28 Y30 E35 D27 D29 S31 Y33 E38
Gene Ontology
Molecular Function
GO:0005499 vitamin D binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0099534 calcium ion binding involved in regulation of presynaptic cytosolic calcium ion concentration
GO:0099567 calcium ion binding involved in regulation of postsynaptic cytosolic calcium ion concentration
Biological Process
GO:0007611 learning or memory
GO:0007614 short-term memory
GO:0007616 long-term memory
GO:0007626 locomotory behavior
GO:0010842 retina layer formation
GO:0010996 response to auditory stimulus
GO:0035502 metanephric part of ureteric bud development
GO:0048167 regulation of synaptic plasticity
GO:0055074 calcium ion homeostasis
GO:0060041 retina development in camera-type eye
GO:0072205 metanephric collecting duct development
GO:0072221 metanephric distal convoluted tubule development
GO:0072286 metanephric connecting tubule development
GO:0090102 cochlea development
GO:0099509 regulation of presynaptic cytosolic calcium ion concentration
GO:0099566 regulation of postsynaptic cytosolic calcium ion concentration
GO:1900271 regulation of long-term synaptic potentiation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030424 axon
GO:0030425 dendrite
GO:0032420 stereocilium
GO:0032437 cuticular plate
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043195 terminal bouton
GO:0043197 dendritic spine
GO:0044305 calyx of Held
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fie, PDBe:6fie, PDBj:6fie
PDBsum6fie
PubMed30289411
UniProtP05937|CALB1_HUMAN Calbindin (Gene Name=CALB1)

[Back to BioLiP]