Structure of PDB 6ffz Chain B

Receptor sequence

>6ffzB (length=346) Species: 1925550 (Rhodococcus sp. M8)

MKAVQYTEIGSEPVVVDIPTPTPGPGEILLKVTAAGLCHSDIHVMDMPAA
QYALGLPLTLGHEGVGTVAELGEGVTGFGVGDAVAVYGPWGCGACHACAR
GRENYCTRAADLGITPPGLGSPGSMAEYMIVDSARHLVPIGDLDPVAAAP
LTDAGLTPYHAISRVLPLLGPGSTAVVIGVGGLGHVGIQILRAVSAARVI
AVDLDDDRLALAREVGADAAVKSGAGAADAIRELTGGQGATAVFDFVGAQ
STIDTAQQVVAVDGHISVVGIHAGAHAKVGFFMIPFGASVVTPYWGTRSE
LMEVVALARAGRLDIHTETFTLDEGPAAYRRLREGSIRGRGVVVPT

3D structure

• PDB: 6ffz Directed Evolution of Alcohol Dehydrogenase for Improved Stereoselective Redox Transformations of 1-Phenylethane-1,2-diol and Its Corresponding Acyloin.
• Chain: B
• Resolution: 1.71 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C92 C95 C98 C106	C92 C95 C98 C106
BS02	ZN	B	C38 H62 D153	C38 H62 D153
BS03	NAD	B	C38 H39 S40 H43 D153 T157 V180 G181 G182 L183 D203 L204 R208 S223 F246 V247 T252 V269 G270 I271 Y294 R340	C38 H39 S40 H43 D153 T157 V180 G181 G182 L183 D203 L204 R208 S223 F246 V247 T252 V269 G270 I271 Y294 R340

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 10:01:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ffz', asym_id = 'B', title = 'Directed Evolution of Alcohol Dehydrogenase for ...ylethane-1,2-diol and Its Corresponding Acyloin. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ffz', asym_id='B', title='Directed Evolution of Alcohol Dehydrogenase for ...ylethane-1,2-diol and Its Corresponding Acyloin. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008270,0016491', uniprot = '', pdbid = '6ffz', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008270,0016491', uniprot='', pdbid='6ffz', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>