Structure of PDB 6fbr Chain B

Receptor sequence
>6fbrB (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRCLI
DKRQRNRCQYCRYQKCLAMGMKREAVQEERQ
3D structure
PDB6fbr Modulation of RXR-DNA complex assembly by DNA context.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S127 H128 M129 K145 H146 Y147 K156 R164 Q206 E208 R209 S2 H3 M4 K20 H21 Y22 K31 R39 Q77 E79 R80
BS02 dna B E153 G154 R161 R184 N185 Q188 R191 R209 E28 G29 R36 R55 N56 Q59 R62 R80
BS03 ZN B C135 C138 C152 C155 C10 C13 C27 C30
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fbr, PDBe:6fbr, PDBj:6fbr
PDBsum6fbr
PubMed30476562
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]