Structure of PDB 6fb9 Chain B

Receptor sequence

>6fb9B (length=153) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDA

3D structure

• PDB: 6fb9 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
• Chain: B
• Resolution: 2.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G219 D220
• Catalytic site (residue number reindexed from 1): G18 D19
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S232 Y233 K234 Q238 R268 R270 E280 I281 K316 K339	S31 Y32 K33 Q37 R67 R69 E79 I80 K115 K138
BS02	dna	B	D220 T246 Q247 K248 R251	D19 T45 Q46 K47 R50
BS03	dna	B	G219 S222 Q226 K228 A333 N336 D337 S338 R341 K342	G18 S21 Q25 K27 A132 N135 D136 S137 R140 K141

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:6fb9, PDBe:6fb9, PDBj:6fb9
• PDBsum: 6fb9
• PubMed: 29980759
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI