Structure of PDB 6fb5 Chain B

Receptor sequence

>6fb5B (length=154) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSGKFKHKLSLTFKVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSNYYLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQVAALNDSKTRKTTSETVRAV
LDSL

3D structure

PDB

6fb5 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.

Chain

Resolution

2.2 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G19 D20
Catalytic site (residue number reindexed from 1)	G18 D19
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	S32 G33 K38 Y66 Y68 S70 Y77 I81 K116 D137 K139	S31 G32 K37 Y65 Y67 S69 Y76 I80 K115 D136 K138
BS02	dna	B	G19 D20 G21 S22 I24 Q26 K28 T46 Q47 K48 R51 V73 N136 D137 S138 T140 R141 K142	G18 D19 G20 S21 I23 Q25 K27 T45 Q46 K47 R50 V72 N135 D136 S137 T139 R140 K141
BS03	MG	B	A134 N136	A133 N135

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fb5, PDBe:6fb5, PDBj:6fb5
PDBsum	6fb5
PubMed	29980759
UniProt	P05725\|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]