Structure of PDB 6fb1 Chain B

Receptor sequence

>6fb1B (length=154) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSGKFKHKLSLTFKVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSNYYLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQVAALNDSKTRKTTSETVRAV
LDSL

3D structure

• PDB: 6fb1 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
• Chain: B
• Resolution: 3.024 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G19 D20
• Catalytic site (residue number reindexed from 1): G18 D19
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S32 G33 K34 K38 Y66 Y68 S70 E80 K116 K139	S31 G32 K33 K37 Y65 Y67 S69 E79 K115 K138
BS02	dna	B	D20 T46 Q47 K48 R51 V73	D19 T45 Q46 K47 R50 V72
BS03	dna	B	G19 S22 Q26 K28 K44 T46 K98 N136 D137 S138 K142	G18 S21 Q25 K27 K43 T45 K97 N135 D136 S137 K141

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:6fb1, PDBe:6fb1, PDBj:6fb1
• PDBsum: 6fb1
• PubMed: 29980759
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI