Structure of PDB 6f83 Chain B

Receptor sequence

>6f83B (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]

ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFN
AHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL
PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD

3D structure

PDB

6f83 Aromatic heterocycle galectin-1 interactions for selective single-digit nM affinity ligands

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5KT	B	S29 V31 H44 R48 E71 R73 D123 G124	S29 V31 H44 R48 E71 R73 D123 G124

Gene Ontology

	Biological Process
GO:0002317	plasma cell differentiation
GO:0006915	apoptotic process
GO:0007165	signal transduction
GO:0031295	T cell costimulation
GO:0042981	regulation of apoptotic process
GO:0043065	positive regulation of apoptotic process
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045445	myoblast differentiation
GO:0046598	positive regulation of viral entry into host cell
GO:0050729	positive regulation of inflammatory response
GO:0098609	cell-cell adhesion
GO:2000329	negative regulation of T-helper 17 cell lineage commitment
GO:2001200	positive regulation of dendritic cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005788	endoplasmic reticulum lumen
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:1990724	galectin complex

External links

PDB	RCSB:6f83, PDBe:6f83, PDBj:6f83
PDBsum	6f83
PubMed
UniProt	P09382\|LEG1_HUMAN Galectin-1 (Gene Name=LGALS1)