Structure of PDB 6f4g Chain B

Receptor sequence
>6f4gB (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
GAMEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKM
RGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAK
3D structure
PDB6f4g Molecular principles underlying dual RNA specificity in the Drosophila SNF protein.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B Y10 N12 N13 E16 K17 K20 K24 V41 A42 L43 K44 K47 M48 R49 Q51 F53 K77 S84 K85 S86 D87 S88 D89 Y12 N14 N15 E18 K19 K22 K26 V43 A44 L45 K46 K49 M50 R51 Q53 F55 K79 S86 K87 S88 D89 S90 D91
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6f4g, PDBe:6f4g, PDBj:6f4g
PDBsum6f4g
PubMed29880797
UniProtP43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A (Gene Name=snf)

[Back to BioLiP]