Structure of PDB 6f2g Chain B |
>6f2gB (length=131) Species: 9844 (Lama glama) [Search protein sequence] |
QVQLVESGGGVVQAGGSLRLSCAASGRTFSSRAMGWFRQAPGEGREFVAT ISWSGSYTEYADSVKGRVTISRDNAKNTVYLQMNSLKPGDTAVYHCAAKN GGAASNYPNDYVYWGQGTQVTVSSHHHHHHE |
|
PDB | 6f2g L amino acid transporter structure and molecular bases for the asymmetry of substrate interaction. |
Chain | B |
Resolution | 2.92 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H125 H127 |
H125 H127 |
|
|
|