Structure of PDB 6evq Chain B |
>6evqB (length=70) Species: 10090 (Mus musculus) [Search protein sequence] |
DEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ RIVDILYATDEGFVIPDEGG |
|
PDB | 6evq Targeting SxIP-EB1 interaction: An integrated approach to the discovery of small molecule modulators of dynamic binding sites. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
C05 |
B |
L246 Y247 |
L56 Y57 |
PDBbind-CN: -logKd/Ki=2.00,Kd=10mM |
|
|
|