Structure of PDB 6eoj Chain B

Receptor sequence

>6eojB (length=94) Species: 559292 (Saccharomyces cerevisiae S288C)

PSLIHPDTAKYPFKFEPFLRQEYSFSLDPDRPICEFYNSREGPKSCPRGP
LCPKKHVLPIFQNKIVCRHWLRGLCKKNDQCEYLHEYNLRKMPE

3D structure

• PDB: 6eoj Architecture of eukaryotic mRNA 3'-end processing machinery.
• Chain: B
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C67 C75 C81 H85	C67 C75 C81 H85
BS02	ZN	B	C34 C46 C52 H56	C34 C46 C52 H56

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006397 mRNA processing
• GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled

Cellular Component

• GO:0005634 nucleus
• GO:0005829 cytosol
• GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

External links

• PDB: RCSB:6eoj, PDBe:6eoj, PDBj:6eoj
• PDBsum: 6eoj
• PubMed: 29074584
• UniProt: Q06102|YTH1_YEAST mRNA 3'-end-processing protein YTH1 (Gene Name=YTH1)