Structure of PDB 6eo0 Chain B

Receptor sequence

>6eo0B (length=275) Species: 7955 (Danio rerio)

DPFTKMTRPSSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFW
RKWQAQDLATPEAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEAR
LGQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHK
SPICPALDGKGAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETL
DSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNME
CTPATQRFKYHFEGPCGSTLPPALE

3D structure

• PDB: 6eo0 Mechanism-Based Inhibitors of the Human Sirtuin 5 Deacylase: Structure-Activity Relationship, Biostructural, and Kinetic Insight.
• Chain: B
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P64 T65 F66 R67 N137 D139 H154
• Catalytic site (residue number reindexed from 1): P41 T42 F43 R44 N114 D116 H131
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C162 C165 C203 C208	C139 C142 C180 C185
BS02	BVT	B	G54 A55 G56 F66 R67 R101 Q136 I138 H154 V217 F219 G220 E221 T222 G245 T246 S247 V250 Y251 N271 M272 C289	G31 A32 G33 F43 R44 R78 Q113 I115 H131 V194 F196 G197 E198 T199 G222 T223 S224 V227 Y228 N248 M249 C266
BS03	BVT	B	E232 M255 F256	E209 M232 F233

Gene Ontology

Molecular Function

• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:6eo0, PDBe:6eo0, PDBj:6eo0
• PDBsum: 6eo0
• PubMed: 29044784
• UniProt: Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=sirt5)