Structure of PDB 6elg Chain B |
>6elgB (length=104) Species: 562 (Escherichia coli) [Search protein sequence] |
QQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLFLLPDEREALG TRVRIVEELLRGEMSQRELKNELGAGIAIITRGSNYLKAAPVELRQWLEE VLLK |
|
PDB | 6elg A biosensor for the direct visualization of auxin |
Chain | B |
Resolution | 1.38 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3BO |
B |
R54 I81 G85 Y88 |
R52 I79 G83 Y86 |
|
|
|
|