Structure of PDB 6ehj Chain B

Receptor sequence

>6ehjB (length=376) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLI
REITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSTM
QRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEE
VEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIG
DGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 6ehj High-resolution snapshots of human N-myristoyltransferase in action illuminate a mechanism promoting N-terminal Lys and Gly myristoylation.
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	B	Y117 Q118 F119 W120 Y180 V181 L248 C249 V250 R255 S256 R258 A260 L287	Y3 Q4 F5 W6 Y66 V67 L134 C135 V136 R141 S142 R144 A146 L173
BS02	ASN	B	F190 Y296 N473	F76 Y182 N353
BS03	LYS	B	E182 D183 F190	E68 D69 F76
BS04	SER	B	H298 D471 G472	H184 D351 G352
BS05	LYS	B	D183 D185 H298 G470 D471	D69 D71 H184 G350 D351
BS06	PRO	B	F311 I469	F197 I349

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6ehj, PDBe:6ehj, PDBj:6ehj
• PDBsum: 6ehj
• PubMed: 32111831
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)