Structure of PDB 6egy Chain B

Receptor sequence

>6egyB (length=108) Species: 4932 (Saccharomyces cerevisiae)

AEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEG
YSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLI
TYLKKATE

3D structure

• PDB: 6egy Noncovalent PEGylation via Sulfonatocalix[4]arene-A Crystallographic Proof.
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	B4T	B	N70 K73 G77	N75 K78 G82
BS02	HEC	B	C14 C17 H18 L32 I35 S40 Y46 Y48 T49 N52 M64 Y67 L68 T78 K79 M80 L94	C19 C22 H23 L37 I40 S45 Y51 Y53 T54 N57 M69 Y72 L73 T83 K84 M85 L99
BS03	B4T	B	R13 G83 K86 K87	R18 G88 K91 K92

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:6egy, PDBe:6egy, PDBj:6egy
• PDBsum: 6egy
• PubMed: 30445810
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)