Structure of PDB 6ebx Chain B |
>6ebxB (length=62) Species: 8631 (Laticauda semifasciata) [Search protein sequence] |
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGI KLSCCESEVCNN |
|
PDB | 6ebx Structure determination of a dimeric form of erabutoxin-b, crystallized from a thiocyanate solution. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SCN |
B |
S23 C54 |
S23 C54 |
|
|
|
|