Structure of PDB 6e7p Chain B

Receptor sequence
>6e7pB (length=475) Species: 9606 (Homo sapiens) [Search protein sequence]
EEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSN
QLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYL
ALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPM
VVTDCIQVDPPERPSSYKNLTLKFHKLVNVTIHFRLKTINLQSLINNEIP
DCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSFRLLF
DVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEFV
NGWYILLVTSDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVGV
IRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYH
VKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGRSSLVWLFSQLYLYSF
ISLFIYMVLSLFIALITGAYDTIKH
3D structure
PDB6e7p Structural basis for PtdInsP2-mediated human TRPML1 regulation.
ChainB
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HZ7 B K55 R61 K65 R322 Y355 K18 R24 K28 R271 Y304
Gene Ontology
Molecular Function
GO:0005253 monoatomic anion channel activity
GO:0005261 monoatomic cation channel activity
GO:0005262 calcium channel activity
GO:0005267 potassium channel activity
GO:0005272 sodium channel activity
GO:0005381 iron ion transmembrane transporter activity
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0008324 monoatomic cation transmembrane transporter activity
GO:0042802 identical protein binding
GO:0072345 NAADP-sensitive calcium-release channel activity
GO:0097682 intracellularly phosphatidylinositol-3,5-bisphosphate-gated monatomic cation channel activity
GO:0099604 ligand-gated calcium channel activity
Biological Process
GO:0002250 adaptive immune response
GO:0006812 monoatomic cation transport
GO:0006816 calcium ion transport
GO:0019722 calcium-mediated signaling
GO:0033572 transferrin transport
GO:0034220 monoatomic ion transmembrane transport
GO:0034755 iron ion transmembrane transport
GO:0035725 sodium ion transmembrane transport
GO:0051209 release of sequestered calcium ion into cytosol
GO:0051289 protein homotetramerization
GO:0070588 calcium ion transmembrane transport
GO:0071277 cellular response to calcium ion
GO:0071467 cellular response to pH
GO:0071805 potassium ion transmembrane transport
GO:0090382 phagosome maturation
GO:0097352 autophagosome maturation
GO:0098655 monoatomic cation transmembrane transport
GO:0098656 monoatomic anion transmembrane transport
GO:1901660 calcium ion export
GO:1905673 positive regulation of lysosome organization
Cellular Component
GO:0001891 phagocytic cup
GO:0005654 nucleoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005770 late endosome
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0031902 late endosome membrane
GO:0042995 cell projection
GO:0043231 intracellular membrane-bounded organelle
GO:0043235 receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6e7p, PDBe:6e7p, PDBj:6e7p
PDBsum6e7p
PubMed30305615
UniProtQ9GZU1|MCLN1_HUMAN Mucolipin-1 (Gene Name=MCOLN1)

[Back to BioLiP]