Structure of PDB 6e7k Chain B

Receptor sequence

>6e7kB (length=422) Species: 9606 (Homo sapiens) [Search protein sequence]

RDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHG
WTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLV
GQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITG
LDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVD
IYPNGGTFQPGCNIGEAGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYR
CSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKASSKMYLKTRSQMPYKV
FHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYS
FLIYTEVDIGELLMLKLKWKSDSSSPGFAIQKIRVKAGETQKKVIFCSRE
KVSHLQKGKAPAVFVKCHDKSL

3D structure

PDB

6e7k Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis.

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	W82 S159 L160 D183 H268
Catalytic site (residue number reindexed from 1)	W51 S128 L129 D152 H228
Enzyme Commision number	3.1.1.32: phospholipase A1. 3.1.1.34: lipoprotein lipase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	A194 P195 R197 S199 D202	A163 P164 R166 S168 D171

Gene Ontology

	Molecular Function
GO:0004465	lipoprotein lipase activity
GO:0004620	phospholipase activity
GO:0004806	triacylglycerol lipase activity
GO:0005102	signaling receptor binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008201	heparin binding
GO:0008970	phospholipase A1 activity
GO:0016298	lipase activity
GO:0016787	hydrolase activity
GO:0034185	apolipoprotein binding
GO:0042803	protein homodimerization activity
GO:0043395	heparan sulfate proteoglycan binding
GO:0043495	protein-membrane adaptor activity
GO:0046872	metal ion binding
GO:0052689	carboxylic ester hydrolase activity
GO:0052739	phosphatidylserine 1-acylhydrolase activity
GO:0071813	lipoprotein particle binding

	Biological Process
GO:0006629	lipid metabolic process
GO:0006631	fatty acid metabolic process
GO:0006633	fatty acid biosynthetic process
GO:0006641	triglyceride metabolic process
GO:0006644	phospholipid metabolic process
GO:0009617	response to bacterium
GO:0009749	response to glucose
GO:0010744	positive regulation of macrophage derived foam cell differentiation
GO:0010884	positive regulation of lipid storage
GO:0010886	positive regulation of cholesterol storage
GO:0010890	positive regulation of sequestering of triglyceride
GO:0016042	lipid catabolic process
GO:0019433	triglyceride catabolic process
GO:0031670	cellular response to nutrient
GO:0032722	positive regulation of chemokine production
GO:0032731	positive regulation of interleukin-1 beta production
GO:0032755	positive regulation of interleukin-6 production
GO:0032760	positive regulation of tumor necrosis factor production
GO:0034371	chylomicron remodeling
GO:0034372	very-low-density lipoprotein particle remodeling
GO:0034375	high-density lipoprotein particle remodeling
GO:0042632	cholesterol homeostasis
GO:0045600	positive regulation of fat cell differentiation
GO:0050729	positive regulation of inflammatory response
GO:0055096	low-density lipoprotein particle mediated signaling
GO:0070328	triglyceride homeostasis
GO:0071398	cellular response to fatty acid
GO:1904179	positive regulation of adipose tissue development
GO:2000343	positive regulation of chemokine (C-X-C motif) ligand 2 production

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005886	plasma membrane
GO:0009986	cell surface
GO:0034361	very-low-density lipoprotein particle
GO:0042627	chylomicron
GO:1902494	catalytic complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6e7k, PDBe:6e7k, PDBj:6e7k
PDBsum	6e7k
PubMed	30559189
UniProt	P06858\|LIPL_HUMAN Lipoprotein lipase (Gene Name=LPL)

[Back to BioLiP]