Structure of PDB 6e4p Chain B |
>6e4pB (length=69) Species: 5691 (Trypanosoma brucei) [Search protein sequence] |
HMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAA RAITELQASELEGATLFLR |
|
PDB | 6e4p The RRM of the kRNA-editing protein TbRGG2 uses multiple surfaces to bind and remodel RNA. |
Chain | B |
Resolution | 1.949 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B |
W215 K219 F230 C231 |
W15 K19 F30 C31 |
|
|
|
|