Structure of PDB 6dyi Chain B

Receptor sequence
>6dyiB (length=106) Species: 562 (Escherichia coli) [Search protein sequence]
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMWDFRHGFDHLVGHIDDALKLANEGKVKEAQAAAEQLKTHCNA
CHQKYR
3D structure
PDB6dyi An efficient, step-economical strategy for the design of functional metalloproteins.
ChainB
Resolution1.964 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CO B H67 H71 H97 H67 H71 H97
BS02 HEC B E4 M7 L10 N11 P46 F65 C98 C101 H102 Y105 R106 E4 M7 L10 N11 P46 F65 C98 C101 H102 Y105 R106
BS03 CA B K19 D21 K19 D21
BS04 CA B D2 D5 D2 D5
BS05 CA B E4 D5 E8 E4 D5 E8
BS06 CA B A1 D39 A1 D39
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0022900 electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6dyi, PDBe:6dyi, PDBj:6dyi
PDBsum6dyi
PubMed30778140
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)

[Back to BioLiP]