Structure of PDB 6dy8 Chain B

Receptor sequence

>6dy8B (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMWDFRHGFDHLVYHIDDALKLANEGKVKEAQAAAEQLKCECNA
CHQKYR

3D structure

• PDB: 6dy8 An efficient, step-economical strategy for the design of functional metalloproteins.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	H67 H71	H67 H71
BS02	HEC	B	M7 L10 N11 P46 F61 F65 E97 C98 C101 H102 Y105 R106	M7 L10 N11 P46 F61 F65 E97 C98 C101 H102 Y105 R106

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:6dy8, PDBe:6dy8, PDBj:6dy8
• PDBsum: 6dy8
• PubMed: 30778140
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)