Structure of PDB 6dk1 Chain B

Receptor sequence
>6dk1B (length=220) Species: 9606 (Homo sapiens) [Search protein sequence]
SMQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQY
AGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHAS
LSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPG
ETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTL
FYTLRSYARGLRLELTTYLF
3D structure
PDB6dk1 Structural basis for sigma1receptor ligand recognition.
ChainB
Resolution3.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GM4 B V84 A86 W89 Y103 Y120 E172 A185 V85 A87 W90 Y104 Y121 E173 A186 BindingDB: Ki=3.1nM,Kd=11.6nM,IC50=8.2nM
Gene Ontology
Molecular Function
GO:0004985 G protein-coupled opioid receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
Biological Process
GO:0006869 lipid transport
GO:0007399 nervous system development
GO:0038003 G protein-coupled opioid receptor signaling pathway
GO:0043523 regulation of neuron apoptotic process
GO:0070207 protein homotrimerization
GO:0150052 regulation of postsynapse assembly
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005637 nuclear inner membrane
GO:0005640 nuclear outer membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0070161 anchoring junction
GO:0098794 postsynapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dk1, PDBe:6dk1, PDBj:6dk1
PDBsum6dk1
PubMed30291362
UniProtQ99720|SGMR1_HUMAN Sigma non-opioid intracellular receptor 1 (Gene Name=SIGMAR1)

[Back to BioLiP]