Structure of PDB 6dil Chain B |
>6dilB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEIAGHKAIGTVVVGPTPVNIIGRNLLTQIGATLNF |
|
PDB | 6dil Drug Resistance Mutation L76V Alters Nonpolar Interactions at the Flap-Core Interface of HIV-1 Protease. |
Chain | B |
Resolution | 1.482 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
TPV |
B |
R8 D25 I50 |
R8 D25 I50 |
MOAD: Ki=7.6nM PDBbind-CN: -logKd/Ki=8.12,Ki=7.6nM |
|
|
|