Structure of PDB 6d6r Chain B

Receptor sequence
>6d6rB (length=241) Species: 9606 (Homo sapiens) [Search protein sequence]
LELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVY
GPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQL
RQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPM
RDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDA
RLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASILLG
3D structure
PDB6d6r Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
ChainB
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B L3 T82 E84 K86 H174 L1 T80 E82 K84 H172
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003723 RNA binding
GO:0004532 RNA exonuclease activity
GO:0005515 protein binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
Biological Process
GO:0000460 maturation of 5.8S rRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006401 RNA catabolic process
GO:0016075 rRNA catabolic process
GO:0030307 positive regulation of cell growth
GO:0034475 U4 snRNA 3'-end processing
GO:0045006 DNA deamination
GO:0051607 defense response to virus
GO:0071028 nuclear mRNA surveillance
GO:0071044 histone mRNA catabolic process
GO:0071051 poly(A)-dependent snoRNA 3'-end processing
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle
GO:0101019 nucleolar exosome (RNase complex)
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d6r, PDBe:6d6r, PDBj:6d6r
PDBsum6d6r
PubMed29906447
UniProtQ9NPD3|EXOS4_HUMAN Exosome complex component RRP41 (Gene Name=EXOSC4)

[Back to BioLiP]